General Information

    • DRAMP ID

    • DRAMP03489

    • Peptide Name

    • Defense protein 6 (DFP-6; Insects, animals)

    • Source

    • Lonomia obliqua (Moth)

    • Family

    • Belongs to the invertebrate defensin family

    • Gene

    • Not found

    • Sequence

    • LTVRAAQSFGRCNQKQCDADCVKKGYFGGLCTLTSCFCTGSRS

    • Sequence Length

    • 43

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03489 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03489.

Physicochemical Information

    • Formula

    • C192H309N59O61S6

    • Absent Amino Acids

    • EHIMPW

    • Common Amino Acids

    • C

    • Mass

    • 4612.28

    • PI

    • 8.92

    • Basic Residues

    • 6

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +4

    • Boman Index

    • -76.54

    • Hydrophobicity

    • -0.161

    • Aliphatic Index

    • 47.67

    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 44.4

    • Polar Residues

    • 21

DRAMP03489

DRAMP03489 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity (By similarity).

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • A catalog for the transcripts from the venomous structures of the caterpillar Lonomia obliqua: identification of the proteins potentially involved in the coagulation disorder and hemorrhagic syndrome.

    • Reference

    • Gene. 2005 Aug 1;355:11-27.

    • Author

    • Veiga AB, Ribeiro JM, Guimarães JA, Francischetti IM.