General Information

    • DRAMP ID

    • DRAMP03492

    • Peptide Name

    • Defensin heliomicin (Mutation: K23L, R24L)

    • Source

    • Heliothis virescens (tobacco budworm)

    • Family

    • Belongs to the invertebrate defensin family (Type 2 subfamily)

    • Gene

    • Not found

    • Sequence

    • DKLIGSCVWGAVNYTSDCNGECLLRGYKGGHCGSFANVNCWCET

    • Sequence Length

    • 44

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03492 helical wheel diagram

    • PDB ID

    • 1I2V resolved by NMR.

    • Predicted Structure

    • There is no predicted structure for DRAMP03492.

Physicochemical Information

    • Formula

    • C201H301N57O64S6

    • Absent Amino Acids

    • MPQ

    • Common Amino Acids

    • G

    • Mass

    • 4732.3

    • PI

    • 5.48

    • Basic Residues

    • 4

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 12

    • Net Charge

    • 0

    • Boman Index

    • -46.6

    • Hydrophobicity

    • -0.105

    • Aliphatic Index

    • 59.77

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 14355

    • Absorbance 280nm

    • 333.84

    • Polar Residues

    • 24

DRAMP03492

DRAMP03492 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Solution structures of the antifungal heliomicin and a selected variant with both antibacterial and antifungal activities.

    • Reference

    • Biochemistry. 2001 Oct 9;40(40):11995-12003.

    • Author

    • Lamberty M, Caille A, Landon C, Tassin-Moindrot S, Hetru C, Bulet P, Vovelle F.