General Information

    • DRAMP ID

    • DRAMP03493

    • Peptide Name

    • Defensin heliomicin (Insects, animals)

    • Source

    • Heliothis virescens (Tobacco budworm moth)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

    • Sequence Length

    • 44

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Neurospora crassa (MIC=0.1-0.2 µM), Fusarium culmorum (MIC=0.2-0.4 µM), Fusarium oxysporum (MIC=1.5-3 µM), Nectria haematococca (MIC=0.4-0.8 µM), Aspergillus fumigatus (MIC=6-12 µM), Trichoderma viride (MIC=1.5-3 µM), Candida albicans (MIC=2.5-5 µM), Cryptococcus neoformans (MIC=2.5-5 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys7 and Cys32,Cys18 and Cys40, Cys22 and Cys42.

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03493 helical wheel diagram
  • 1I2U-> 
    1I2V-> 

    • Predicted Structure

    • There is no predicted structure for DRAMP03493.

Physicochemical Information

    • Formula

    • C201H303N61O64S6

    • Absent Amino Acids

    • MPQ

    • Common Amino Acids

    • G

    • Mass

    • 4790.35

    • PI

    • 7.77

    • Basic Residues

    • 6

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +2

    • Boman Index

    • -76.91

    • Hydrophobicity

    • -0.468

    • Aliphatic Index

    • 42.05

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 14355

    • Absorbance 280nm

    • 333.84

    • Polar Residues

    • 24

DRAMP03493

DRAMP03493 chydropathy plot

Comments Information

    • Similar to plant defensin RsAFP2 (also in structure), it interacts with glucosylceramide isolated from the membranes of yeast and soybean but not humans (J Biol Chem 2004; 279

    • 3900-3905). Transgenic plants

Literature Information

  • ·Literature 1

    • Title

    • Insect immunity. Isolation from the lepidopteran Heliothis virescens of a novel insect defensin with potent antifungal activity.

    • Reference

    • J Biol Chem. 1999 Apr 2;274(14):9320-9326.

    • Author

    • Lamberty M, Ades S, Uttenweiler-Joseph S, Brookhart G, Bushey D, Hoffmann JA, Bulet P.
  • ·Literature 2

    • Title

    • Solution structures of the antifungal heliomicin and a selected variant with both antibacterial and antifungal activities.

    • Reference

    • Biochemistry. 2001 Oct 9;40(40):11995-2003.

    • Author

    • Lamberty M, Caille A, Landon C, Tassin-Moindrot S, Hetru C, Bulet P, Vovelle F.