• DRAMP ID

    • DRAMP03493
    • Peptide Name

    • Defensin heliomicin (Insects, animals)
    • Source

    • Heliothis virescens (Tobacco budworm moth)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET
    • Sequence Length

    • 44
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antifungal
    • Target Organism

      • Fungi: Neurospora crassa (MIC=0.1-0.2 µM), Fusarium culmorum (MIC=0.2-0.4 µM), Fusarium oxysporum (MIC=1.5-3 µM), Nectria haematococca (MIC=0.4-0.8 µM), Aspergillus fumigatus (MIC=6-12 µM), Trichoderma viride (MIC=1.5-3 µM), Candida albicans (MIC=2.5-5 µM), Cryptococcus neoformans (MIC=2.5-5 µM).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys7 and Cys32,Cys18 and Cys40, Cys22 and Cys42.
    • Stereochemistry

    • Not included yet
    • Structure

    • Combine helix and strand structure
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03493 helical wheel diagram
    • Predicted Structure

    • There is no predicted structure for DRAMP03493.
    • Formula

    • C201H303N61O64S6
    • Absent Amino Acids

    • MPQ
    • Common Amino Acids

    • G
    • Mass

    • 4790.35
    • PI

    • 7.77
    • Basic Residues

    • 6
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 10
    • Net Charge

    • +2
    • Boman Index

    • -76.91
    • Hydrophobicity

    • -0.468
    • Aliphatic Index

    • 42.05
    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 14355
    • Absorbance 280nm

    • 333.84
    • Polar Residues

    • 24

DRAMP03493

DRAMP03493 chydropathy plot
    • Similar to plant defensin RsAFP2 (also in structure), it interacts with glucosylceramide isolated from the membranes of yeast and soybean but not humans (J Biol Chem 2004; 279

    • 3900-3905). Transgenic plants
  • ·Literature 1
    • Title

    • Insect immunity. Isolation from the lepidopteran Heliothis virescens of a novel insect defensin with potent antifungal activity.
    • Reference

    • J Biol Chem. 1999 Apr 2;274(14):9320-9326.
    • Author

    • Lamberty M, Ades S, Uttenweiler-Joseph S, Brookhart G, Bushey D, Hoffmann JA, Bulet P.
  • ·Literature 2
    • Title

    • Solution structures of the antifungal heliomicin and a selected variant with both antibacterial and antifungal activities.
    • Reference

    • Biochemistry. 2001 Oct 9;40(40):11995-2003.
    • Author

    • Lamberty M, Caille A, Landon C, Tassin-Moindrot S, Hetru C, Bulet P, Vovelle F.