General Information

    • DRAMP ID

    • DRAMP03495

    • Peptide Name

    • Psychimicin (Insects, animals)

    • Source

    • Oiketicus kirbyi (Bagworm moth)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • INNWVRVPPCDQVCSRTNPEKDECCRAHGHAFHATCSGGMQCYRR

    • Sequence Length

    • 45

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03495 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03495.

Physicochemical Information

    • Formula

    • C211H327N73O64S7

    • Absent Amino Acids

    • L

    • Common Amino Acids

    • C

    • Mass

    • 5134.79

    • PI

    • 8.35

    • Basic Residues

    • 9

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +5

    • Boman Index

    • -127.64

    • Hydrophobicity

    • -0.811

    • Aliphatic Index

    • 34.67

    • Half Life

      • Mammalian:20 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 167.39

    • Polar Residues

    • 17

DRAMP03495

DRAMP03495 chydropathy plot

Comments Information

    • Function

    • Has antimicrobial activity. Is particularly active against fungi, and to a lesser extent against Gram-positive and Gram-negative bacteria.

    • Tissue specificity

    • Hemolymph.

    • PTM

    • Contains three disulfide bonds 10-24; 14-36; 25-42.

Literature Information