General Information

    • DRAMP ID

    • DRAMP03497

    • Peptide Name

    • Cecropin-B (Insects, animals)

    • Source

    • Heliothis virescens (Tobacco budworm moth)

    • Family

    • Belongs to the cecropin family

    • Gene

    • Not found

    • Sequence

    • KWKVFKKIEKVGRNIRDGIVKAGPAIAVLGQAN

    • Sequence Length

    • 33

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03497 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03497.

Physicochemical Information

    • Formula

    • C165H279N49O41

    • Absent Amino Acids

    • CHMSTY

    • Common Amino Acids

    • K

    • Mass

    • 3605.33

    • PI

    • 10.66

    • Basic Residues

    • 8

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +6

    • Boman Index

    • -40.42

    • Hydrophobicity

    • -0.164

    • Aliphatic Index

    • 106.36

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 171.88

    • Polar Residues

    • 6

DRAMP03497

DRAMP03497 chydropathy plot

Comments Information

    • Function

    • Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria. Has also activity against fungi.

    • Induction

    • By bacterial infection.

Literature Information

  • ·Literature 1

    • Title

    • Unknown

    • Reference

    • Submitted (JUL-2002) to UniProtKB.

    • Author

    • Bulet P, Lamberty M, Brookhart G, Bushey D.