• DRAMP ID

    • DRAMP03497
    • Peptide Name

    • Cecropin-B (Insects, animals)
    • Source

    • Heliothis virescens (Tobacco budworm moth)
    • Family

    • Belongs to the cecropin family
    • Gene

    • Not found
    • Sequence

    • KWKVFKKIEKVGRNIRDGIVKAGPAIAVLGQAN
    • Sequence Length

    • 33
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03497 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03497.
    • Formula

    • C165H279N49O41
    • Absent Amino Acids

    • CHMSTY
    • Common Amino Acids

    • K
    • Mass

    • 3605.33
    • PI

    • 10.66
    • Basic Residues

    • 8
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 15
    • Net Charge

    • +6
    • Boman Index

    • -40.42
    • Hydrophobicity

    • -0.164
    • Aliphatic Index

    • 106.36
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 5500
    • Absorbance 280nm

    • 171.88
    • Polar Residues

    • 6

DRAMP03497

DRAMP03497 chydropathy plot
    • Function

    • Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria. Has also activity against fungi.
    • Induction

    • By bacterial infection.
  • ·Literature 1
    • Title

    • Unknown
    • Reference

    • Submitted (JUL-2002) to UniProtKB.
    • Author

    • Bulet P, Lamberty M, Brookhart G, Bushey D.