General Information

    • DRAMP ID

    • DRAMP03500

    • Peptide Name

    • Virescein (Insects, animals)

    • Source

    • Heliothis virescens (Tobacco budworm moth)

    • Family

    • Belongs to the moricin family

    • Gene

    • Not found

    • Sequence

    • GKIPIGAIKKAGKAIGKGLRAVNIASTAHDVYTFFKPKKRH

    • Sequence Length

    • 41

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03500 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03500.

Physicochemical Information

    • Formula

    • C202H336N60O49

    • Absent Amino Acids

    • CEMQW

    • Common Amino Acids

    • K

    • Mass

    • 4389.26

    • PI

    • 10.84

    • Basic Residues

    • 12

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 16

    • Net Charge

    • +11

    • Boman Index

    • -48.48

    • Hydrophobicity

    • -0.273

    • Aliphatic Index

    • 85.85

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1490

    • Absorbance 280nm

    • 37.25

    • Polar Residues

    • 10

DRAMP03500

DRAMP03500 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity against Gram-positive and Gram-negative bacteria.

    • Tissue specificity

    • Hemolymph.

    • Induction

    • By bacterial infection.

Literature Information

  • ·Literature 1

    • Title

    • Unknown

    • Reference

    • Submitted (JUL-2002) to UniProtKB.

    • Author

    • Bulet P, Lamberty M, Charlet M, Sabatier L, Rabel D.