• • DRAMP ID

  • DRAMP03501

• • Peptide Name

  • La-LTP (LJAFP; Insects, animals)

• • Source

  • Leonurus japonicus (Chinese motherwort) (Leonurus artemisia)

• • Family

  • Not found

• • Gene

  • Afp

• • Sequence

  • AIGCNTVASKMAPCLPYVTGKGPLGGCCGGVKGLIDAARTTPDRQAVCNCLKTLAKSYSGINLGNAAGLPGKCGVSIPYQISPNTDCSKVH

• • Sequence Length

  • 91

• • UniProt Entry

  • Q52RN7

• • Protein Existence

  • Homology

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

• • Target Organism

  • • Gram-positive Bacteria: Bacillus subtilis (IC50>15 µM).
    • Gram-negative Bacteria: Pseudomonas solanacearum (IC50=7.5-15 µM), Ralstonia solanacearum (IC50=15 µM).
    • Fungi: Alternaria alternate (IC50<7.5 µM), Alternaria brassicae (IC50<7.5 µM), Aspergillus niger (IC50<7.5 µM), Bipolaris maydis (IC50<7.5 µM), Botrytis cinerea (IC50=7.5-15 µM), Cerospora personata (IC50=7.5-15 µM), Colletotrichum gloeosporiodes (IC50<7.5 µM), Fusarium graminearum (IC50=7.5-15 µM), Fusarium oxysporum (IC50=7.5-15 µM), Penicillium digitatum (IC50>15 µM), Pyricularia grisea (IC50=7.5-15 µM), Rhizoctonia solani (IC50<7.5 µM), Rhizoctonia cerealis (IC50=7.5-15 µM), Saccharomyces cerevisiae (IC50>15 µM), Sclerotinia sclerotiorum (IC50>15 µM), Trichoderma harzianum (IC50=7.5-15 µM), Verticillium dahliae (IC50=7.5-15 µM).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Lipid-binding

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Nonterminal Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP03501.

DRAMP03501

• • Function

  • Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity).

• ·Literature 1

• • Title

  • LJAFP, a novel non-specific lipid transfer protein-like antimicrobial protein from motherwort (Leonurus japonicus) confers disease resistance against phytopathogenic fungi and bacterium in transgenic tobacco.

• • Pubmed ID

  • PubMed ID is not available

• • Reference

  • Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases

• • Author

  • Yang X, Xiao Y, Pei Y, Zhen C.