• DRAMP ID

    • DRAMP03507
    • Peptide Name

    • Cecropin-B (Insects, animals)
    • Source

    • Antheraea pernyi (Chinese oak silkmoth)
    • Family

    • Belongs to the cecropin family
    • Gene

    • Not found
    • Sequence

    • KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL
    • Sequence Length

    • 35
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal
    • Target Organism

      • Gram-negative bacteria: Escherichia coli D21 (MIC=0.36 µM), Escherichia coli D31 (MIC=0.30 µM), Serratia marsescens (MIC=2.6 µM), Serratia marsescens Strain 122 (MIC=12 µM), Pseudomonas aeruginosa OT97 (MIC=2.9 µM), Xenorhabdus nematophilus Xn21 (MIC=1.6 µM);
      • Gram-positive bacteria: Bacillus subtilis Bsll (MIC=17 µM), Bacillus megaterium Bmll (MIC=0.64 µM), Bacillus thuringiensis Btll (MIC>88 µM), Streptococcus fecalis Ds16 (MIC>88 µM), Streptococcus fecalis AD-4 (MIC>88 µM), Micrococcus luteus MI11 (MIC=0.29 µM).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Amidation
    • Nonterminal Modifications and Unusual Amino Acids

    • Free
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03507 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03507.
    • Formula

    • C177H303N51O42
    • Absent Amino Acids

    • CDHMQSTY
    • Common Amino Acids

    • K
    • Mass

    • 3817.67
    • PI

    • 10.73
    • Basic Residues

    • 9
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 17
    • Net Charge

    • +7
    • Boman Index

    • -30.91
    • Hydrophobicity

    • 0.003
    • Aliphatic Index

    • 117.14
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 5500
    • Absorbance 280nm

    • 161.76
    • Polar Residues

    • 6

DRAMP03507

DRAMP03507 chydropathy plot
    • Function

    • Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria.
  • ·Literature 1
    • Title

    • Insect immunity: isolation and structure of cecropins B and D from pupae of the Chinese oak silk moth, Antheraea pernyi.
    • Reference

    • Eur J Biochem. 1982 Sep;127(1):219-224.
    • Author

    • Qu Z, Steiner H, Engström A, Bennich H, Boman HG.
  • ·Literature 2
    • Title

    • Plasma desorption mass spectrometry coupled with conventional peptide sequencing techniques.
    • Reference

    • Biomed Environ Mass Spectrom. 1987 Nov;14(11):669-673.
    • Author

    • Craig AG, Engström A, Bennich H, Kamensky I.