General Information

    • DRAMP ID

    • DRAMP03507

    • Peptide Name

    • Cecropin-B (Insects, animals)

    • Source

    • Antheraea pernyi (Chinese oak silkmoth)

    • Family

    • Belongs to the cecropin family

    • Gene

    • Not found

    • Sequence

    • KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL

    • Sequence Length

    • 35

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • Gram-negative bacteria: Escherichia coli D21 (MIC=0.36 µM), Escherichia coli D31 (MIC=0.30 µM), Serratia marsescens (MIC=2.6 µM), Serratia marsescens Strain 122 (MIC=12 µM), Pseudomonas aeruginosa OT97 (MIC=2.9 µM), Xenorhabdus nematophilus Xn21 (MIC=1.6 µM);
      • Gram-positive bacteria: Bacillus subtilis Bsll (MIC=17 µM), Bacillus megaterium Bmll (MIC=0.64 µM), Bacillus thuringiensis Btll (MIC>88 µM), Streptococcus fecalis Ds16 (MIC>88 µM), Streptococcus fecalis AD-4 (MIC>88 µM), Micrococcus luteus MI11 (MIC=0.29 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Amidation

    • Nonterminal Modifications and Unusual Amino Acids

    • Free

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03507 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C177H303N51O42

    • Absent Amino Acids

    • CDHMQSTY

    • Common Amino Acids

    • K

    • Mass

    • 3817.67

    • PI

    • 10.73

    • Basic Residues

    • 9

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 17

    • Net Charge

    • +7

    • Boman Index

    • -30.91

    • Hydrophobicity

    • 0.003

    • Aliphatic Index

    • 117.14

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 161.76

    • Polar Residues

    • 6

DRAMP03507

DRAMP03507 chydropathy plot

Comments Information

    • Function

    • Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria.

Literature Information

  • ·Literature 1

    • Title

    • Insect immunity: isolation and structure of cecropins B and D from pupae of the Chinese oak silk moth, Antheraea pernyi.

    • Reference

    • Eur J Biochem. 1982 Sep;127(1):219-224.

    • Author

    • Qu Z, Steiner H, Engström A, Bennich H, Boman HG.
  • ·Literature 2

    • Title

    • Plasma desorption mass spectrometry coupled with conventional peptide sequencing techniques.

    • Reference

    • Biomed Environ Mass Spectrom. 1987 Nov;14(11):669-673.

    • Author

    • Craig AG, Engström A, Bennich H, Kamensky I.