• • DRAMP ID

  • DRAMP03509

• • Peptide Name

  • Cecropin-A (Insects, animals)

• • Source

  • Trichoplusia ni (Cabbage looper)

• • Family

  • Belongs to the cecropin family

• • Gene

  • Not found

• • Sequence

  • RWKFFKKIEKVGQNIRDGIIKAGPAVAVVGQAASIT

• • Sequence Length

  • 36

• • UniProt Entry

  • P50724

• • Protein Existence

  • Homology

• • Biological Activity

  • Antimicrobial, Antibacterial

• • Target Organism

  • No MICs found in DRAMP database

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Nonterminal Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP03509.

DRAMP03509

• • Comment

  • No comments found on DRAMP database

• ·Literature 1

• • Title

  • PCR differential display of immune gene expression in Trichoplusia ni.

• • Pubmed ID

  • 8882660

• • Reference

  • Insect Biochem Mol Biol. 1996 Feb;26(2):177-184.

• • Author

  • Kang D, Liu G, Gunne H, Steiner H.