General Information

    • DRAMP ID

    • DRAMP03510

    • Peptide Name

    • Cecropin A

    • Source

    • Hyalophora cecropia

    • Family

    • cecropin

    • Gene

    • Not found

    • Sequence

    • KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK

    • Sequence Length

    • 37

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • [Ref.7140755] Gram-negative bacterium: Escherichia coli D21 (LC=0.19 µM), Escherichia coli D31 (LC=0.21 µM), Serratia marcescens Db11 (LC=4.2 µM), Serratia marcescens Db1108 (LC=2.5 µM), Serratia marcescens Db1121 (LC=4.4 µM), Serratia marcescens Strain 122 (LC=3.2 µM), Pseudomonas aeruginosa OT97 (LC=4.8 µM), Xenorhabdus nematophilus Xn21 (LC=1.4 µM).
      • [Ref.29925795]Gram-negative bacterium:Escherichia coli CVCC 245 (MIC=4.2 ± 0.35μg/mL);
      • Gram-positive bacteria:Staphylococcus aureus ATCC 25923 (MIC=198 ± 10.1μg/mL),L. mono. CVCC 1599 (MIC=64.5 ± 3.20μg/mL)

    • Hemolytic Activity

      • [Ref.29925795] 50% hemolysis at 169 ± 8.20 μg/ml against sheep red blood cells.

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Amidation

    • Nonterminal Modifications and Unusual Amino Acids

    • Free

    • Stereochemistry

    • L

    • Structure

    • Alpha-helix

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03510 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP03510.

Physicochemical Information

    • Formula

    • C184H312N52O47

    • Absent Amino Acids

    • CHMSY

    • Common Amino Acids

    • K

    • Mass

    • 4004.82

    • PI

    • 10.39

    • Basic Residues

    • 8

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 17

    • Net Charge

    • +6

    • Boman Index

    • -31.33

    • Hydrophobicity

    • -0.073

    • Aliphatic Index

    • 108.11

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 152.78

    • Polar Residues

    • 6

DRAMP03510

DRAMP03510 chydropathy plot

Comments Information

    • Function

    • Antibacterial activity against the Gram-negative bacteria and Gram-positive bacteria. Has hemolytic activity.

Literature Information

  • ·Literature 1

    • Title

    • Insect immunity: isolation and structure of cecropin D and four minor antibacterial components from Cecropia pupae.

    • Reference

    • Eur J Biochem. 1982 Sep;127(1):207-217.

    • Author

    • Hultmark D, Engstr?m A, Bennich H, Kapur R, Boman HG.
  • ·Literature 2

    • Title

    • Expression, Purification, and Characterization of a Novel Hybrid Peptide with Potent Antibacterial Activity

    • Reference

    • Molecules. 2018 Jun 20;23(6):1491.

    • Author

    • Wei X, Wu R, Zhang L, Ahmad B, Si D, Zhang R.