• • DRAMP ID

  • DRAMP03510

• • Peptide Name

  • Cecropin A

• • Source

  • Hyalophora cecropia

• • Family

  • cecropin

• • Gene

  • Not found

• • Sequence

  • KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK

• • Sequence Length

  • 37

• • UniProt Entry

  • P01507

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

• • Target Organism

  • • [Ref.7140755] Gram-negative bacterium: Escherichia coli D21 (LC=0.19 µM), Escherichia coli D31 (LC=0.21 µM), Serratia marcescens Db11 (LC=4.2 µM), Serratia marcescens Db1108 (LC=2.5 µM), Serratia marcescens Db1121 (LC=4.4 µM), Serratia marcescens Strain 122 (LC=3.2 µM), Pseudomonas aeruginosa OT97 (LC=4.8 µM), Xenorhabdus nematophilus Xn21 (LC=1.4 µM).
    • [Ref.29925795]Gram-negative bacterium:Escherichia coli CVCC 245 (MIC=4.2 ± 0.35μg/mL);
    • Gram-positive bacteria:Staphylococcus aureus ATCC 25923 (MIC=198 ± 10.1μg/mL),L. mono. CVCC 1599 (MIC=64.5 ± 3.20μg/mL)

• • Hemolytic Activity

  • • [Ref.29925795] 50% hemolysis at 169 ± 8.20 μg/ml against sheep red blood cells.

• • Cytotoxicity

  • No cytotoxicity information found in the reference(s) presented

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Linear

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Amidation

• • Nonterminal Modifications and Unusual Amino Acids

  • Free

• • Stereochemistry

  • L

• • Structure

  • Alpha-helix

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • 1D9J

• Predicted Structure

• There is no predicted structure for DRAMP03510.

DRAMP03510

• • Function

  • Antibacterial activity against the Gram-negative bacteria and Gram-positive bacteria. Has hemolytic activity.

• ·Literature 1

• • Title

  • Insect immunity: isolation and structure of cecropin D and four minor antibacterial components from Cecropia pupae.

• • Pubmed ID

  • 7140755

• • Reference

  • Eur J Biochem. 1982 Sep;127(1):207-217.

• • Author

  • Hultmark D, Engstr?m A, Bennich H, Kapur R, Boman HG.

• ·Literature 2

• • Title

  • Expression, Purification, and Characterization of a Novel Hybrid Peptide with Potent Antibacterial Activity

• • Pubmed ID

  • 29925795

• • Reference

  • Molecules. 2018 Jun 20;23(6):1491.

• • Author

  • Wei X, Wu R, Zhang L, Ahmad B, Si D, Zhang R.