General Information

    • DRAMP ID

    • DRAMP03511

    • Peptide Name

    • Cecropin-B (Immune protein P9; Insects, animals)

    • Source

    • Hyalophora cecropia (Cecropia moth)

    • Family

    • Belongs to the cecropin family

    • Gene

    • Not found

    • Sequence

    • KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL

    • Sequence Length

    • 35

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-negative bacteria: Escherichia coli D21 (MLC=0.32 µM), Escherichia coli D31 (MLC=0.32 µM), Serratia marcescens Db11 (MLC=4.5 µM), Serratia marcescens Db1108 (MLC=2.4 µM), Serratia marcescens Db1121 (MLC=2.2 µM), Serratia marcescens Strain 122 (MLC=2.9 µM), Pseudomonas aeruginosa OT97 (MLC=1.9 µM), Xenorhabdus nematophilus Xn21 (MLC=1.6 µM);
      • Gram-positive bacteria: Bacillus megaterium Bmll (MLC=0.44 µM), Bacillus subtilis Bs11 (MLC=18 µM), B.thuringiensis Bt11 (MLC>133 µM), Streptococcus fecalis AD-4 (MLC=7.3 µM), Streptococcus fecalis DS16 (MLC>24 µM), Micrococcus luteus M111 (MLC=1.3 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03511 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03511.

Physicochemical Information

    • Formula

    • C176H301N51O42S

    • Absent Amino Acids

    • CDHQSTY

    • Common Amino Acids

    • K

    • Mass

    • 3835.7

    • PI

    • 10.73

    • Basic Residues

    • 9

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 16

    • Net Charge

    • +7

    • Boman Index

    • -33.48

    • Hydrophobicity

    • -0.071

    • Aliphatic Index

    • 106

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 161.76

    • Polar Residues

    • 6

DRAMP03511

DRAMP03511 chydropathy plot

Comments Information

    • Function

    • Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria.

Literature Information

  • ·Literature 1

    • Title

    • Insect immunity: isolation and structure of cecropin D and four minor antibacterial components from Cecropia pupae.

    • Reference

    • Eur J Biochem. 1982 Sep;127(1):207-217.

    • Author

    • Hultmark D, Engström A, Bennich H, Kapur R, Boman HG.