• DRAMP ID

    • DRAMP03517
    • Peptide Name

    • Moricin-like peptide C3 (Gm-mlpC3; Insects, animals; Predicted)
    • Source

    • Galleria mellonella (Greater wax moth)
    • Family

    • Not found
    • Gene

    • mor
    • Sequence

    • KVPIGAIKKGGKIIKKGLGVIGAAGTAHEVYSHVKNRQ
    • Sequence Length

    • 38
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal
    • Target Organism

      • Gram-negative bacterium: Escherichia coli (MIC=100 µM);
      • Gram-positive bacterium: Micrococcus luteus (MIC=100 µM).
      • Fungi: Fusarium graminearum spores (MIC=10 µM), Fusarium oxysporum spores (MIC=100 µM).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • Free
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03517 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C177H304N54O46
    • Absent Amino Acids

    • CDFMW
    • Common Amino Acids

    • GK
    • Mass

    • 3924.69
    • PI

    • 10.47
    • Basic Residues

    • 10
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 14
    • Net Charge

    • +9
    • Boman Index

    • -28.69
    • Hydrophobicity

    • -0.147
    • Aliphatic Index

    • 102.63
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 1490
    • Absorbance 280nm

    • 40.27
    • Polar Residues

    • 11

DRAMP03517

DRAMP03517 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • The discovery and analysis of a diverged family of novel antifungal moricin-like peptides in the wax moth Galleria mellonella.
    • Reference

    • Insect Biochem Mol Biol. 2008;38:201-212.
    • Author

    • Brown SE, Howard A, Kasprzak AB, Gordon KH, East PD.