General Information

    • DRAMP ID

    • DRAMP03522

    • Peptide Name

    • Gallerimycin (defensins; Insects, animals)

    • Source

    • Galleria mellonella (Greater wax moth)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MKIAFIVAISLAFLAVTSCIEFEKSTESHDIQKRGVTITVKPPFPGCVFYECIANCRSRGYKNGGYCTINGCQCLR

    • Sequence Length

    • 76

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • Metarhizium anisopliae

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03522 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03522.

Physicochemical Information

    • Formula

    • C372H590N100O105S8

    • Absent Amino Acids

    • W

    • Common Amino Acids

    • IC

    • Mass

    • 8399.86

    • PI

    • 8.77

    • Basic Residues

    • 10

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 26

    • Net Charge

    • +5

    • Boman Index

    • -74.1

    • Hydrophobicity

    • 0.217

    • Aliphatic Index

    • 82.11

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4845

    • Absorbance 280nm

    • 64.6

    • Polar Residues

    • 29

DRAMP03522

DRAMP03522 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Cloning and expression of gallerimycin, an antifungal peptide expressed in immune response of greater wax moth larvae, Galleria mellonella.

    • Reference

    • Arch Insect Biochem Physiol. 2003 Jul;53(3):125-133.

    • Author

    • Schuhmann B, Seitz V, Vilcinskas A, Podsiadlowski L.