• • DRAMP ID

  • DRAMP03524

• • Peptide Name

  • Lebocin-like anionic peptide 1 (Insects, animals)

• • Source

  • Galleria mellonella (Greater wax moth)

• • Family

  • Not found

• • Gene

  • Not found

• • Sequence

  • EADEPLWLYKGDNIERAPTTADHPILPSIIDDVKLDPNRRYA

• • Sequence Length

  • 42

• • UniProt Entry

  • P85211

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Antifungal

• • Target Organism

  • • Gram-positive bacteria: Micrococcus luteus(MIC=22.7 µM), Listeria monocytogenes (MIC=90.9 µM).
    • Fungi: Aspergillus niger (MIC=90.9 µM), Trichoderma harzianum (MIC=90.9 µM).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Linear

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

  • Free

• • Stereochemistry

  • L

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP03524.

DRAMP03524

• • Comment

  • No comments found on DRAMP database

• ·Literature 1

• • Title

  • Purification and characterization of eight peptides from Galleria mellonella immune hemolymph.

• • Pubmed ID

  • 17194500

• • Reference

  • Peptides. 2007;28:533-546.

• • Author

  • Cytrynska M, Mak P, Zdybicka-Barabas A, Suder P, Jakubowicz T.