General Information

    • DRAMP ID

    • DRAMP03526

    • Peptide Name

    • Proline-rich antimicrobial peptide 2 (Insects, animals)

    • Source

    • Galleria mellonella (Greater wax moth)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • EIRLPEPFRFPSPTVPKPIDIDPILPHPWSPRQTYPIIARRS

    • Sequence Length

    • 42

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacterium: Micrococcus luteus (MIC=8.6 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Free

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03526 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03526.

Physicochemical Information

    • Formula

    • C231H358N62O58

    • Absent Amino Acids

    • CGMN

    • Common Amino Acids

    • P

    • Mass

    • 4931.76

    • PI

    • 9.97

    • Basic Residues

    • 7

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +3

    • Boman Index

    • -83.39

    • Hydrophobicity

    • -0.583

    • Aliphatic Index

    • 83.57

    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 6990

    • Absorbance 280nm

    • 170.49

    • Polar Residues

    • 6

DRAMP03526

DRAMP03526 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Purification and characterization of eight peptides from Galleria mellonella immune hemolymph.

    • Reference

    • Peptides. 2007 Mar;28(3):533-546.

    • Author

    • CytryÅ„ska M, Mak P, Zdybicka-Barabas A, Suder P, Jakubowicz T.