General Information

    • DRAMP ID

    • DRAMP03528

    • Peptide Name

    • Defensin (Galiomicin; Insects, animals)

    • Source

    • Galleria mellonella (Greater wax moth)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • DTLIGSCVWGATNYTSDCNAECKRRGYKGGHCGSFLNVNCWCE

    • Sequence Length

    • 43

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Aspergillus niger (MIC=2.1 µM), Candida albicans (MIC=8.5 µM), C. fructus (MIC=8.5 µM), Fusarium oxysporum (MIC=16.9 µM), Pichia pastoris (MIC=16.9 µM), Pachysolen tannophilus (MIC=8.5 µM), Trichoderma harzianum (MIC=4.2 µM), Zygosaccharomyces Marxianus (MIC=8.5 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys7 and Cys32,Cys18 and Cys40, Cys22 and Cys42.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03528 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03528.

Physicochemical Information

    • Formula

    • C198H297N59O64S6

    • Absent Amino Acids

    • MPQ

    • Common Amino Acids

    • CG

    • Mass

    • 4720.25

    • PI

    • 6.71

    • Basic Residues

    • 5

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +1

    • Boman Index

    • -73.99

    • Hydrophobicity

    • -0.405

    • Aliphatic Index

    • 45.35

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 14355

    • Absorbance 280nm

    • 341.79

    • Polar Residues

    • 24

DRAMP03528

DRAMP03528 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Purification and characterization of eight peptides from Galleria mellonella immune hemolymph.

    • Reference

    • Peptides. 2007 Mar;28(3):533-546.

    • Author

    • Cytrynska M, Mak P, Zdybicka-Barabas A, Suder P, Jakubowicz T.
  • ·Literature 2

    • Title

    • Purification, cDNA cloning and expression of an insect defensin from the great wax moth, Galleria mellonella.

    • Reference

    • Insect Mol Biol 2004; 13: 65-72.

    • Author

    • Lee Y.S, Yun E.K, Jang W.S, Kim I, Lee J.H, Park S.Y, Ryu K.S, Seo S.J, Kim C.H, Lee I.H.