General Information

    • DRAMP ID

    • DRAMP03531

    • Peptide Name

    • Cecropin-D (Insects, animals)

    • Source

    • Bombyx mori (Silk moth)

    • Family

    • Belongs to the cecropin family

    • Gene

    • CECD

    • Sequence

    • GNFFKDLEKMGQRVRDAVISAAPAVDTLAKAKALGQ

    • Sequence Length

    • 36

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03531 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03531.

Physicochemical Information

    • Formula

    • C168H279N49O50S

    • Absent Amino Acids

    • CHWY

    • Common Amino Acids

    • A

    • Mass

    • 3817.42

    • PI

    • 9.52

    • Basic Residues

    • 6

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 16

    • Net Charge

    • +2

    • Boman Index

    • -53.1

    • Hydrophobicity

    • -0.133

    • Aliphatic Index

    • 86.94

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 0

    • Absorbance 280nm

    • 0

    • Polar Residues

    • 6

DRAMP03531

DRAMP03531 chydropathy plot

Comments Information

    • Function

    • Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria.

    • Induction

    • By bacterial infection.

Literature Information

  • ·Literature 1

    • Title

    • cDNA cloning and gene expression of cecropin D, an antibacterial protein in the silkworm, Bombyx mori.

    • Reference

    • Comp Biochem Physiol B Biochem Mol Biol. 1999 Apr;122(4):409-414.

    • Author

    • Yang J, Furukawa S, Sagisaka A, Ishibashi J, Taniai K, Shono T, Yamakawa M.