General Information

    • DRAMP ID

    • DRAMP03534

    • Peptide Name

    • Antibacterial peptide enbocin (Moricin; Insects, animals)

    • Source

    • Bombyx mori (Silk moth)

    • Family

    • Belongs to the cecropin family

    • Gene

    • Not found

    • Sequence

    • PWNIFKEIERAVARTRDAVISAGPAVRTVAAATSVAS

    • Sequence Length

    • 37

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-positive bacteria: Bacillus subtilis, Bacillus thuringiensis, Staphyllococcus aureus;
      • Gram-negative bacteria: Psedomonas solanacearum, Salmonellar typhimurium, Escherichia coli.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03534 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03534.

Physicochemical Information

    • Formula

    • C171H282N52O51

    • Absent Amino Acids

    • CHLMQY

    • Common Amino Acids

    • A

    • Mass

    • 3882.44

    • PI

    • 10.67

    • Basic Residues

    • 5

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 19

    • Net Charge

    • +2

    • Boman Index

    • -54.62

    • Hydrophobicity

    • 0.232

    • Aliphatic Index

    • 95.14

    • Half Life

      • Mammalian:>20 hour
      • Yeast:>20 hour
      • E.coli:?

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 152.78

    • Polar Residues

    • 8

DRAMP03534

DRAMP03534 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity against Gram-positive and Gram-negative bacteria.

Literature Information

  • ·Literature 1

    • Title

    • Cloning and expression of a novel gene encoding a new antibacterial peptide from silkworm, Bombyx mori.

    • Reference

    • Biochem Biophys Res Commun. 1998 May 19;246(2):388-392.

    • Author

    • Kim SH, Park BS, Yun EY, Je YH, Woo SD, Kang SW, Kim KY, Kang SK.