General Information

    • DRAMP ID

    • DRAMP03536

    • Peptide Name

    • Lebocin-3 (LEB 3; Insects, animals)

    • Source

    • Bombyx mori (Silk moth)

    • Family

    • Belongs to the lebocin family

    • Gene

    • LEB3

    • Sequence

    • DLRFLYPRGKLPVPTLPPFNPKPIYIDMGNRY

    • Sequence Length

    • 32

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-negative bacteria: Acinetobacter sp. NISL B-4653, Escherichia coli HB1ll, Pseudomonas fluorescens IAM1179;
      • Gram-positive bacterium: Staphylococcus aureus ATCC 6538P.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Cell membrane

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • A unique threonine residue in each peptide was O-glycosylated and the modification seemed to be important for expression of antibacterial activity.

    • Helical Wheel Diagram

    • DRAMP03536 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03536.

Physicochemical Information

    • Formula

    • C180H275N45O43S

    • Absent Amino Acids

    • ACEHQSW

    • Common Amino Acids

    • P

    • Mass

    • 3789.5

    • PI

    • 9.82

    • Basic Residues

    • 5

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +3

    • Boman Index

    • -45.82

    • Hydrophobicity

    • -0.5

    • Aliphatic Index

    • 82.19

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4470

    • Absorbance 280nm

    • 144.19

    • Polar Residues

    • 8

DRAMP03536

DRAMP03536 chydropathy plot

Comments Information

    • Function

    • Antibacterial peptide.

Literature Information

  • ·Literature 1

    • Title

    • A novel antibacterial peptide family isolated from the silkworm, Bombyx mori.

    • Reference

    • Biochem J. 1995 Sep 1;310 (Pt 2):651-656.

    • Author

    • Hara S, Yamakawa M.
  • ·Literature 2

    • Title

    • A novel member of lebocin gene family from the silkworm, Bombyx mori.

    • Reference

    • Biochem Biophys Res Commun. 1997 Sep 29;238(3):769-774.

    • Author

    • Furukawa S, Taniai K, Ishibashi J, Hara S, Shono T, Yamakawa M.