General Information

    • DRAMP ID

    • DRAMP03540

    • Peptide Name

    • Human drosomycin-like defensin (DLD; Human, mammals, animals)

    • Source

    • Homo sapiens (Human)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • CLAGRLDKQCTCRRSQPSRRSGHEVGRPSPHCGPSRQCGCHMD

    • Sequence Length

    • 43

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Filamentous fungi: Aspergillus fumigatus (MIC=6.25 µM), A. nidulans (MIC=6.25 µM), A. ustus (MIC=12.5 µM), Fusarium solani (MIC=25 µM), F. oxysporum (MIC=6.25 µM), R. oryzae (MIC=6.25 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Has three disulfide bonds

    • Stereochemistry

    • L

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03540 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03540.

Physicochemical Information

    • Formula

    • C186H310N74O59S7

    • Absent Amino Acids

    • FINWY

    • Common Amino Acids

    • R

    • Mass

    • 4751.39

    • PI

    • 9.25

    • Basic Residues

    • 11

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 4

    • Net Charge

    • +8

    • Boman Index

    • -153.99

    • Hydrophobicity

    • -1.13

    • Aliphatic Index

    • 27.21

    • Half Life

      • Mammalian:1.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 375

    • Absorbance 280nm

    • 8.93

    • Polar Residues

    • 17

DRAMP03540

DRAMP03540 chydropathy plot

Comments Information

    • Function

    • This is the first indication of an endogenous human peptide with specific antifungal activity, which is probably central in the defense against infections with molds.

Literature Information

  • ·Literature 1

    • Title

    • Drosomycin-like defensin, a human homologue of Drosophila melanogaster drosomycin with antifungal activity.

    • Reference

    • Antimicrob Agents Chemother 2008; 52: 1407-1412.

    • Author

    • Simon A et al Netea MG.