• DRAMP ID

    • DRAMP03549
    • Peptide Name

    • ALL-38 (Human, mammals, animals)
    • Source

    • Homo sapiens (Human)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • ALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
    • Sequence Length

    • 38
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Not found
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03549 helical wheel diagram
    • Predicted Structure

    • There is no predicted structure for DRAMP03549.
    • Formula

    • C208H345N61O54
    • Absent Amino Acids

    • CHMWY
    • Common Amino Acids

    • K
    • Mass

    • 4564.4
    • PI

    • 10.61
    • Basic Residues

    • 11
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 14
    • Net Charge

    • +6
    • Boman Index

    • -109.19
    • Hydrophobicity

    • -0.658
    • Aliphatic Index

    • 89.74
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 0
    • Absorbance 280nm

    • 0
    • Polar Residues

    • 6

DRAMP03549

DRAMP03549 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Processing of seminal plasma hCAP-18 to ALL-38 by gastricsin: a novel mechanism of generating antimicrobial peptides in vagina.
    • Reference

    • J Biol Chem. 2003 Aug 1;278(31):28540-6.
    • Author

    • Sørensen OE, Gram L, Johnsen AH, Andersson E, Bangsbøll S, Tjabringa GS, Hiemstra PS, Malm J, Egesten A, Borregaard N.