General Information

    • DRAMP ID

    • DRAMP03555

    • Peptide Name

    • CCL20(2-70) (Human, mammals, animals)

    • Source

    • Homo sapiens (Human)

    • Family

    • Belongs to the intercrine beta (chemokine CC) family

    • Gene

    • CCL20

    • Sequence

    • SNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM

    • Sequence Length

    • 69

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-negative bacterium: Escherichia coli ATCC 25922,
      • Gram-positive bacterium: Staphylococcus aureus ATCC 29213.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge (2 disulfide bonds)

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03555 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03555.

Physicochemical Information

    • Formula

    • C360H579N99O94S5

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • K

    • Mass

    • 7958.46

    • PI

    • 9.7

    • Basic Residues

    • 14

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 25

    • Net Charge

    • +10

    • Boman Index

    • -92.83

    • Hydrophobicity

    • -0.106

    • Aliphatic Index

    • 93.19

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8730

    • Absorbance 280nm

    • 128.38

    • Polar Residues

    • 21

DRAMP03555

DRAMP03555 chydropathy plot

Comments Information

    • Function

    • Chemotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes. Inhibits proliferation of myeloid progenitors in colony formation assays. May be involved in formation and function of the mucosal lymphoid tissues by attracting lymphocytes and dendritic cells towards epithelial cells. C-terminal processed forms have been shown to be equally chemotactically active for leukocytes. Possesses antibacterial activity E. coli ATCC 25922 and S. aureus ATCC 29213.

Literature Information

  • ·Literature 1

    • Title

    • The structure of human macrophage inflammatory protein-3alpha /CCL20. Linking antimicrobial and CC chemokine receptor-6-binding activities with human beta-defensins.

    • Reference

    • J Biol Chem. 2002 Oct 4;277(40):37647-54.

    • Author

    • Hoover DM, Boulegue C, Yang D, Oppenheim JJ, Tucker K, Lu W, Lubkowski J.