General Information

    • DRAMP ID

    • DRAMP03558

    • Peptide Name

    • human platelet factor 4 (hPF4; Human, mammals, animals)

    • Source

    • Homo sapiens (Human)

    • Family

    • Belongs to the intercrine alpha (chemokine CxC) family

    • Gene

    • Not found

    • Sequence

    • EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES

    • Sequence Length

    • 70

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antiparasitic

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03558 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03558.

Physicochemical Information

    • Formula

    • C341H580N96O101S4

    • Absent Amino Acids

    • FMW

    • Common Amino Acids

    • L

    • Mass

    • 7769.18

    • PI

    • 8.8

    • Basic Residues

    • 13

    • Acidic Residues

    • 8

    • Hydrophobic Residues

    • 24

    • Net Charge

    • +5

    • Boman Index

    • -102.85

    • Hydrophobicity

    • -0.211

    • Aliphatic Index

    • 108.71

    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1740

    • Absorbance 280nm

    • 25.22

    • Polar Residues

    • 17

DRAMP03558

DRAMP03558 chydropathy plot

Comments Information

    • Function

    • human platelet factor 4 (hPF4) kills malaria parasites inside erythrocytes by selectively lysing the parasite digestive vacuole (DV).

Literature Information

  • ·Literature 1

    • Title

    • Platelet factor 4 activity against P. falciparum and its translation to nonpeptidic mimics as antimalarials.

    • Reference

    • Cell Host Microbe. 2012 Dec 13;12(6):815-823.

    • Author

    • Love MS, Millholland MG, Mishra S, Kulkarni S, Freeman KB, Pan W, Kavash RW, Costanzo MJ, Jo H, Daly TM, Williams DR, Kowalska MA, Bergman LW, Poncz M, DeGrado WF, Sinnis P, Scott RW, Greenbaum DC.