General Information

    • DRAMP ID

    • DRAMP03561

    • Peptide Name

    • CXCL6 (C-X-C motif chemokine 6; Human, mammals, animals)

    • Source

    • Homo sapiens (Human)

    • Family

    • Belongs to the intercrine alpha (chemokine CxC) family

    • Gene

    • CXCL6

    • Sequence

    • GPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN

    • Sequence Length

    • 77

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antiparasitic

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Heparin-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03561 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03561.

Physicochemical Information

    • Formula

    • C369H630N104O104S4

    • Absent Amino Acids

    • HMWY

    • Common Amino Acids

    • KVL

    • Mass

    • 8315.94

    • PI

    • 9.75

    • Basic Residues

    • 13

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 28

    • Net Charge

    • +8

    • Boman Index

    • -88.27

    • Hydrophobicity

    • -0.04

    • Aliphatic Index

    • 103.64

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 250

    • Absorbance 280nm

    • 3.29

    • Polar Residues

    • 21

DRAMP03561

DRAMP03561 chydropathy plot

Comments Information

    • Function

    • Chemotactic for neutrophil granulocytes.

Literature Information

  • ·Literature 1

    • Title

    • The human CXC chemokine granulocyte chemotactic protein 2 (GCP-2)/CXCL6 possesses membrane-disrupting properties and is antibacterial.

    • Reference

    • Antimicrob Agents Chemother. 2008 Jul;52(7):2599-2607.

    • Author

    • Linge HM, Collin M, Nordenfelt P, Mörgelin M, Malmsten M, Egesten A.