General Information

    • DRAMP ID

    • DRAMP03586

    • Peptide Name

    • Human TC-2 (Chain of Platelet basic protein; Human, mammals, animals)

    • Source

    • Homo sapiens (Human)

    • Family

    • Not found

    • Gene

    • PPBP

    • Sequence

    • NLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDES

    • Sequence Length

    • 83

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • Gram-positive bacteria: Bacillus subtilis ATCC6633 (MBC=0.7 µM), Staphylococcus aureus 42D (MBC=11 µM);
      • Gram-negative bacterium: Escherichia coli ML35 (MBC=2.7 µM).
      • Fungi: Cryptococcus neoformans (MFC=30 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03586 helical wheel diagram

    • PDB ID

    • 1F9P resolved by X-ray.
  • 1F9P-> 

    • Predicted Structure

    • There is no predicted structure for DRAMP03586.

Physicochemical Information

    • Formula

    • C392H665N113O124S5

    • Absent Amino Acids

    • FW

    • Common Amino Acids

    • K

    • Mass

    • 9105.57

    • PI

    • 8.41

    • Basic Residues

    • 16

    • Acidic Residues

    • 12

    • Hydrophobic Residues

    • 25

    • Net Charge

    • +4

    • Boman Index

    • -155.23

    • Hydrophobicity

    • -0.446

    • Aliphatic Index

    • 95.18

    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1740

    • Absorbance 280nm

    • 21.22

    • Polar Residues

    • 23

DRAMP03586

DRAMP03586 chydropathy plot

Comments Information

    • PTM

    • Contains two disulfide bonds 19-46; 22-62.

Literature Information

  • ·Literature 1

    • Title

    • Thrombocidins, microbicidal proteins from human blood platelets, are C-terminal deletion products of CXC chemokines.

    • Reference

    • J Biol Chem. 2000 Jul 7;275(27):20374-20381.

    • Author

    • Krijgsveld J, Zaat SA, Meeldijk J, van Veelen PA, Fang G, Poolman B, Brandt E, Ehlert JE, Kuijpers AJ, Engbers GH, Feijen J, Dankert J.
  • ·Literature 2

    • Title

    • Purification, crystallization and preliminary X-ray diffraction analysis of recombinant human neutrophil-activating peptide 2 (rhNAP-2).

    • Reference

    • FEBS Lett. 1994 Jun 27;347(2-3):300-303.

    • Author

    • Kungl AJ, Machius M, Huber R, Schwer C, Lam C, Aschauer H, Ehn G, Lindley IJ, Auer M.