General Information

    • DRAMP ID

    • DRAMP03589

    • Peptide Name

    • WAP four-disulfide core domain protein 12 (Putative protease inhibitor WAP12; Human, mammals, ani

    • Source

    • Homo sapiens (Human)

    • Family

    • Not found

    • Gene

    • WFDC12

    • Sequence

    • VKEGIEKAGVCPADNVRCFKSDPPQCHTDQDCLGERKCCYLHCGFKCVIPVKELEEGGNKDEDVSRPYPEPGWEAKCPGSSSTRCPQK

    • Sequence Length

    • 88

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03589 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03589.

Physicochemical Information

    • Formula

    • C412H647N119O133S10

    • Absent Amino Acids

    • M

    • Common Amino Acids

    • CEKP

    • Mass

    • 9715.99

    • PI

    • 5.66

    • Basic Residues

    • 15

    • Acidic Residues

    • 15

    • Hydrophobic Residues

    • 17

    • Net Charge

    • 0

    • Boman Index

    • -202

    • Hydrophobicity

    • -0.846

    • Aliphatic Index

    • 45.34

    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 9105

    • Absorbance 280nm

    • 104.66

    • Polar Residues

    • 29

DRAMP03589

DRAMP03589 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Identification of a novel protease inhibitor gene that is highly expressed in the prostate.

    • Reference

    • Biochem Biophys Res Commun. 2002 Jan 11;290(1):452-456.

    • Author

    • Lundwall A, Clauss A.