• DRAMP ID

    • DRAMP03593
    • Peptide Name

    • Neutrophil defensin 3 (Defensin, alpha 3; HNP-3, HP-3, HP3; Human, mammals, animals)
    • Source

    • Homo sapiens (Human)
    • Family

    • Belongs to the alpha-defensin family
    • Gene

    • DEFA3
    • Sequence

    • DCYCRIPACIAGERRYGTCIYQGRLWAFCC
    • Sequence Length

    • 30
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antiviral(SARS-CoV-2)
    • Target Organism

      • [Ref.34206990]Virus:SARS-CoV-2:inhibition of infection in HEK293T-hACE2 cells(approximately 50% inbibition at 1 μg/mL (290 nM)).
      • Gram-negative bacteria: Escherichia coli ATCC 8739 (vLD50=6.2±0.9 µg/ml), E. coli ATCC 25922 (vLD50=5.9±2.1 µg/ml), Enterobacter aerogenes ATCC 13048 (vLD50=41±9.2 µg/ml);
      • Gram-positive bacteria: Staphylococcus aureus ATCC 25923 (vLD50=13±2.1 µg/ml), S. aureus ATCC 29213 (vLD50=2.2±0.4 µg/ml), Bacillus cereus ATCC 10876 (vLD50=0.37±0.08 µg/ml).(Ref.2)
      • NOTE: vLD50, virtual lethal doses (vLDs), equivalent to conventional 50% lethal doses (LD50s).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Cyclization(Cys2 and Cys30).
    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys2 and Cys30,Cys4 and Cys19,Cys9 and Cys29.
    • Stereochemistry

    • L
    • Structure

    • Beta strand
    • Structure Description

    • Compared to HNP-2, HNP-3 contains one additional residue (Asp) at the N-terminus. The 3D structures remain the same.
    • Helical Wheel Diagram

    • DRAMP03593 helical wheel diagram
    • Predicted Structure

    • There is no predicted structure for DRAMP03593.
    • Formula

    • C151H228N44O40S6
    • Absent Amino Acids

    • HKMNSV
    • Common Amino Acids

    • C
    • Mass

    • 3492.1
    • PI

    • 8.33
    • Basic Residues

    • 4
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 9
    • Net Charge

    • +2
    • Boman Index

    • -42.82
    • Hydrophobicity

    • 0.123
    • Aliphatic Index

    • 62
    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 10345
    • Absorbance 280nm

    • 356.72
    • Polar Residues

    • 13

DRAMP03593

DRAMP03593 chydropathy plot
    • Function

    • Defensin 3 have antibiotic, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane.
    • PTM

    • Contains three disulfide bonds 2-30; 4-19; 9-29.
  • ·Literature 1
    • Title

    • Human Defensins Inhibit SARS-CoV-2 Infection by Blocking Viral Entry.
    • Reference

    • Viruses. 2021 Jun 26;13(7):1246.
    • Author

    • Xu C, Wang A, Marin M, Honnen W, Ramasamy S, Porter E, Subbian S, Pinter A, Melikyan GB, Lu W, Chang TL.
  • ·Literature 2
    • Title

    • Primary structures of three human neutrophil defensins.
    • Reference

    • J Clin Invest. 1985 Oct;76(4):1436-1439.
    • Author

    • Selsted ME, Harwig SS, Ganz T, Schilling JW, Lehrer RI.
  • ·Literature 3
    • Title

    • Antibacterial activity and specificity of the six human {alpha}-defensins.
    • Reference

    • Antimicrob Agents Chemother. 2005 Jan;49(1):269-275.
    • Author

    • Ericksen B, Wu Z, Lu W, Lehrer RI.