General Information

    • DRAMP ID

    • DRAMP03600

    • Peptide Name

    • Human beta-defensin 4 (hBD-4, BD-4; Beta-defensin 104; Human, mammals, animals)

    • Source

    • Homo sapiens (Human)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB104A

    • Sequence

    • EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP

    • Sequence Length

    • 50

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-positive bacterium: Staphylococcus carnosus TM300 (MIC=4.5 µg/ml);
      • Gram-negative bacteria: Escherichia coli BL21 (MIC>100 µg/ml), Pseudomonas aeruginosa (MIC=4.1 µg/ml).
      • Yeast: Saccharomyces cerevisiae ATCC9763 (MIC>100 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys8 and Cys36,Cys15 and Cys29,Cys19 and Cys37.

    • Stereochemistry

    • L

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03600 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP03600.

Physicochemical Information

    • Formula

    • C254H410N82O74S6

    • Absent Amino Acids

    • HMV

    • Common Amino Acids

    • R

    • Mass

    • 5988.91

    • PI

    • 9.27

    • Basic Residues

    • 12

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +6

    • Boman Index

    • -171.04

    • Hydrophobicity

    • -1.008

    • Aliphatic Index

    • 50.8

    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 10345

    • Absorbance 280nm

    • 211.12

    • Polar Residues

    • 19

DRAMP03600

DRAMP03600 chydropathy plot

Comments Information

    • Function

    • Has antimicrobial activity. Synergistic effects with lysozyme and DEFB103.

    • Tissue specificity

    • High expression in the testis. Gastric antrum exhibited relatively high levels. A lower expression is observed in uterus and neutrophils thyroid gland, lung, and kidney. No detectable expression in other tissues tested.

    • Induction

    • Antimicrobial activity is decreased when the sodium chloride concentration is increased.

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Human beta-defensin 4: a novel inducible peptide with a specific salt-sensitive spectrum of antimicrobial activity.

    • Reference

    • FASEB J. 2001 Aug;15(10):1819-1821.

    • Author

    • García JR, Krause A, Schulz S, Rodríguez-Jiménez FJ, Klüver E, Adermann K, Forssmann U, Frimpong-Boateng A, Bals R, Forssmann WG.