General Information

    • DRAMP ID

    • DRAMP03602

    • Peptide Name

    • Human beta-defensin 27 (hBD-27; hBD27; Human, mammals, animals)

    • Source

    • Homo sapiens (Human)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Not found

    • Sequence

    • QLKKCWNNYVQGHCRKICRVNEVPEALCENGRYCCLNIKELEAC

    • Sequence Length

    • 44

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-

    • Target Organism

      • Gram-negative bacterium: Escherichia coli K12.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03602 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03602.

Physicochemical Information

    • Formula

    • C219H353N67O64S7

    • Absent Amino Acids

    • DFMST

    • Common Amino Acids

    • C

    • Mass

    • 5173.04

    • PI

    • 8.25

    • Basic Residues

    • 8

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +3

    • Boman Index

    • -91.8

    • Hydrophobicity

    • -0.507

    • Aliphatic Index

    • 77.5

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8855

    • Absorbance 280nm

    • 205.93

    • Polar Residues

    • 16

DRAMP03602

DRAMP03602 chydropathy plot

Comments Information

    • Function

    • Both hBD26 and hBD27 showe salt-sensitive antimicrobial activity against gram-negative E. coli but not against gram-positive S. aureus and S. cerevisiae.

Literature Information

  • ·Literature 1

    • Title

    • Soluble fusion expression and characterization of bioactive human beta-defensin 26 and 27.

    • Reference

    • Appl Microbiol Biotechnol. 2009 Aug;84(2):301-308.

    • Author

    • Huang L, Leong SS, Jiang R.