• DRAMP ID

    • DRAMP03606
    • Peptide Name

    • Beta-defensin 107 (Defensin, beta 107; Beta-defensin 7, BD-7; Human, mammals, animals)
    • Source

    • Homo sapiens (Human)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • DEFB107A AND DEFB107
    • Sequence

    • AIHRALISKRMEGHCEAECLTFEVKIGGCRAELAPFCCKNRKKH
    • Sequence Length

    • 44
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03606 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03606.
    • Formula

    • C213H352N68O58S6
    • Absent Amino Acids

    • DQWY
    • Common Amino Acids

    • ACEK
    • Mass

    • 4985.92
    • PI

    • 9.02
    • Basic Residues

    • 12
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 14
    • Net Charge

    • +7
    • Boman Index

    • -87.93
    • Hydrophobicity

    • -0.325
    • Aliphatic Index

    • 71.14
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 250
    • Absorbance 280nm

    • 5.81
    • Polar Residues

    • 11

DRAMP03606

DRAMP03606 chydropathy plot
    • Function

    • Has antibacterial activity.
    • Tissue specificity

    • Specifically expressed in testis.
    • PTM

    • Problely contains two disulfide bonds.
  • ·Literature 1
    • Title

    • DNA sequence and analysis of human chromosome 8.
    • Reference

    • Nature. 2006 Jan 19;439(7074):331-335.
    • Author

    • Nusbaum C, Mikkelsen TS, Zody MC, et al, Lander ES.
  • ·Literature 2
    • Title

    • Duplication and selection in the evolution of primate beta-defensin genes.
    • Reference

    • Genome Biol. 2003;4(5):R31.
    • Author

    • Semple CA, Rolfe M, Dorin JR.
  • ·Literature 3
    • Title

    • Discovery of five conserved beta-defensin gene clusters using a computational search strategy.
    • Reference

    • Proc Natl Acad Sci U S A. 2002 Feb 19;99(4):2129-2133.
    • Author

    • Schutte BC, Mitros JP, Bartlett JA, Walters JD, Jia HP, Welsh MJ, Casavant TL, McCray PB Jr.