General Information

    • DRAMP ID

    • DRAMP03607

    • Peptide Name

    • Putative beta-defensin 108A (Defensin, beta 108A; Human, mammals, animals)

    • Source

    • Homo sapiens (Human)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB108P1 AND DEFB10

    • Sequence

    • KFKEICERPNGSCRDFCLETEIHVGRCLNSRPCCLPLGHQPRIESTTPKKD

    • Sequence Length

    • 51

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03607 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03607.

Physicochemical Information

    • Formula

    • C247H403N77O75S6

    • Absent Amino Acids

    • AMWY

    • Common Amino Acids

    • CEPR

    • Mass

    • 5843.75

    • PI

    • 8.33

    • Basic Residues

    • 11

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +4

    • Boman Index

    • -139.4

    • Hydrophobicity

    • -0.778

    • Aliphatic Index

    • 59.22

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 375

    • Absorbance 280nm

    • 7.5

    • Polar Residues

    • 17

DRAMP03607

DRAMP03607 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity.

    • PTM

    • Problely contains three disulfide bonds 6-33; 13-27; 17-34.

Literature Information

  • ·Literature 1

    • Title

    • DNA sequence and analysis of human chromosome 8.

    • Reference

    • Nature. 2006 Jan 19;439(7074):331-335.

    • Author

    • Nusbaum C, Mikkelsen TS, Zody MC, et al, Lander ES.
  • ·Literature 2

    • Title

    • Duplication and selection in the evolution of primate beta-defensin genes.

    • Reference

    • Genome Biol. 2003;4(5):R31.

    • Author

    • Semple CA, Rolfe M, Dorin JR.