General Information

    • DRAMP ID

    • DRAMP03613

    • Peptide Name

    • Beta-defensin 114 (Beta-defensin 14, DEFB-14; Defensin, beta 114; Human, mammals, animals)

    • Source

    • Homo sapiens (Human)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB114

    • Sequence

    • DRCTKRYGRCKRDCLESEKQIDICSLPRKICCTEKLYEEDDMF

    • Sequence Length

    • 43

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03613 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03613.

Physicochemical Information

    • Formula

    • C217H356N64O71S7

    • Absent Amino Acids

    • AHNVW

    • Common Amino Acids

    • C

    • Mass

    • 5222.02

    • PI

    • 6.37

    • Basic Residues

    • 10

    • Acidic Residues

    • 10

    • Hydrophobic Residues

    • 7

    • Net Charge

    • 0

    • Boman Index

    • -154.29

    • Hydrophobicity

    • -1.012

    • Aliphatic Index

    • 54.42

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 79.88

    • Polar Residues

    • 13

DRAMP03613

DRAMP03613 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity.

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.

    • Reference

    • Physiol Genomics. 2005 Sep 21;23(1):5-17.

    • Author

    • Patil AA, Cai Y, Sang Y, Blecha F, Zhang G.
  • ·Literature 2

    • Title

    • Discovery of five conserved beta-defensin gene clusters using a computational search strategy.

    • Reference

    • Proc Natl Acad Sci U S A. 2002 Feb 19;99(4):2129-33.

    • Author

    • Schutte BC, Mitros JP, Bartlett JA, Walters JD, Jia HP, Welsh MJ, Casavant TL, McCray PB Jr.