General Information

    • DRAMP ID

    • DRAMP03616

    • Peptide Name

    • Beta-defensin 118 (Beta-defensin 18, DEFB-18; Defensin, beta 118; Human, mammals, animals)

    • Source

    • Homo sapiens (Human)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB118

    • Sequence

    • AYSGEKKCWNRSGHCRKQCKDGEAVKDTCKNLRACCIPSNEDH

    • Sequence Length

    • 43

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03616 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03616.

Physicochemical Information

    • Formula

    • C198H319N67O65S6

    • Absent Amino Acids

    • FM

    • Common Amino Acids

    • CK

    • Mass

    • 4870.48

    • PI

    • 8.63

    • Basic Residues

    • 11

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +5

    • Boman Index

    • -140.2

    • Hydrophobicity

    • -1.244

    • Aliphatic Index

    • 31.86

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 175.36

    • Polar Residues

    • 17

DRAMP03616

DRAMP03616 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity.

    • Tissue specificity

    • High-level and epididymis-specific expression. Most abundant in the epithelium of the caput and is also present in the lumen and bound to sperm. Expressed also in pancreas.

    • PTM

    • Contains three disulfide bonds 8-35; 15-29; 19-36.

Literature Information

  • ·Literature 1

    • Title

    • Primate epididymis-specific proteins: characterization of ESC42, a novel protein containing a trefoil-like motif in monkey and human.

    • Reference

    • Endocrinology. 2001 Oct;142(10):4529-4539.

    • Author

    • Liu Q, Hamil KG, Sivashanmugam P, Grossman G, Soundararajan R, Rao AJ, Richardson RT, Zhang YL, O'Rand MG, Petrusz P, French FS, Hall SH.
  • ·Literature 2

    • Title

    • ORFeome-based search of airway epithelial cell-specific novel human [beta]-defensin genes.

    • Reference

    • Am J Respir Cell Mol Biol. 2003 Jul;29(1):71-80.

    • Author

    • Kao CY, Chen Y, Zhao YH, Wu R.