General Information

    • DRAMP ID

    • DRAMP03617

    • Peptide Name

    • Beta-defensin 119 (Beta-defensin 19, DEFB-19; Defensin, beta 119; Human, mammals, animals)

    • Source

    • Homo sapiens (Human)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB119

    • Sequence

    • KRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEENTDWSYEKQWPRLP

    • Sequence Length

    • 63

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03617 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03617.

Physicochemical Information

    • Formula

    • C318H504N98O94S9

    • Absent Amino Acids

    • FV

    • Common Amino Acids

    • CSR

    • Mass

    • 7492.64

    • PI

    • 9.12

    • Basic Residues

    • 12

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +7

    • Boman Index

    • -171.23

    • Hydrophobicity

    • -0.924

    • Aliphatic Index

    • 51.11

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 17335

    • Absorbance 280nm

    • 279.6

    • Polar Residues

    • 26

DRAMP03617

DRAMP03617 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity.

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Discovery of five conserved beta-defensin gene clusters using a computational search strategy.

    • Reference

    • Proc Natl Acad Sci U S A. 2002 Feb 19;99(4):2129-2133.

    • Author

    • Schutte BC, Mitros JP, Bartlett JA, Walters JD, Jia HP, Welsh MJ, Casavant TL, McCray PB Jr.