General Information

    • DRAMP ID

    • DRAMP03624

    • Peptide Name

    • Beta-defensin 128 (Beta-defensin 28, DEFB-28; Defensin, beta 128; Human, mammals, animals)

    • Source

    • Homo sapiens (Human)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB128

    • Sequence

    • ARLKKCFNKVTGYCRKKCKVGERYEIGCLSGKLCCANDEEEKKHVSFKKPHQHSGEKLSVLQDYIILPTITIFTV

    • Sequence Length

    • 75

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03624 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03624.

Physicochemical Information

    • Formula

    • C381H620N106O107S6

    • Absent Amino Acids

    • MW

    • Common Amino Acids

    • K

    • Mass

    • 8590.12

    • PI

    • 9.24

    • Basic Residues

    • 18

    • Acidic Residues

    • 8

    • Hydrophobic Residues

    • 21

    • Net Charge

    • +10

    • Boman Index

    • -133.04

    • Hydrophobicity

    • -0.449

    • Aliphatic Index

    • 79.2

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4845

    • Absorbance 280nm

    • 65.47

    • Polar Residues

    • 24

DRAMP03624

DRAMP03624 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity (Potential).

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • The DNA sequence and comparative analysis of human chromosome 20.

    • Reference

    • Nature. 2001 Dec 20-27;414(6866):865-871.

    • Author

    • Deloukas P, Matthews LH, Ashurst J, Burton J, et al, Rogers J.
  • ·Literature 2

    • Title

    • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).

    • Reference

    • Genome Res. 2004 Oct;14(10B):2121-2127.

    • Author

    • Gerhard DS, Wagner L, Feingold EA, Shenmen CM, et al, Malek J.