General Information

    • DRAMP ID

    • DRAMP03627

    • Peptide Name

    • Beta-defensin 132 (Defensin, beta 132; Beta-defensin 32, BD-32; Human, mammals, animals)

    • Source

    • Homo sapiens (Human)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB132

    • Sequence

    • GGSKCVSNTPGYCRTCCHWGETALFMCNASRKCCISYSFLPKPDLPQLIGNHWQSRRRNTQRKDKKQQTTVTS

    • Sequence Length

    • 73

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03627 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03627.

Physicochemical Information

    • Formula

    • C353H562N112O105S8

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • CSTKR

    • Mass

    • 8311.51

    • PI

    • 9.62

    • Basic Residues

    • 14

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +11

    • Boman Index

    • -184.87

    • Hydrophobicity

    • -0.834

    • Aliphatic Index

    • 42.74

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 14355

    • Absorbance 280nm

    • 199.38

    • Polar Residues

    • 32

DRAMP03627

DRAMP03627 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity (Potential).

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Distribution of new human beta-defensin genes clustered on chromosome 20 in functionally different segments of epididymis.

    • Reference

    • Genomics. 2003 Feb;81(2):175-183.

    • Author

    • Rodriguez-Jimenez FJ, Krause A, Schulz S, Forssmann WG, Conejo-Garcia JR, Schreeb R, Motzkus D.