General Information

    • DRAMP ID

    • DRAMP03628

    • Peptide Name

    • Beta-defensin 133 (Defensin, beta 133; Human, mammals, animals)

    • Source

    • Homo sapiens (Human)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB133

    • Sequence

    • AVKDTYSCFIMRGKCRHECHDFEKPIGFCTKLNANCYM

    • Sequence Length

    • 38

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03628 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03628.

Physicochemical Information

    • Formula

    • C193H296N54O54S7

    • Absent Amino Acids

    • QW

    • Common Amino Acids

    • C

    • Mass

    • 4461.22

    • PI

    • 8.4

    • Basic Residues

    • 8

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +4

    • Boman Index

    • -70.18

    • Hydrophobicity

    • -0.366

    • Aliphatic Index

    • 43.68

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3230

    • Absorbance 280nm

    • 87.3

    • Polar Residues

    • 14

DRAMP03628

DRAMP03628 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity (Potential).

    • PTM

    • Contains two disulfide bonds 8-36; 15-29.

Literature Information

  • ·Literature 1

    • Title

    • Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.

    • Reference

    • Physiol Genomics. 2005 Sep 21;23(1):5-17.

    • Author

    • Patil AA, Cai Y, Sang Y, Blecha F, Zhang G.