• DRAMP ID

    • DRAMP03630
    • Peptide Name

    • Beta-defensin 135 (Defensin, beta 135; Human, mammals, animals)
    • Source

    • Homo sapiens (Human)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • DEFB135
    • Sequence

    • GPNVYIQKIFASCWRLQGTCRPKCLKNEQYRILCDTIHLCCVNPKYLPILTGK
    • Sequence Length

    • 53
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03630 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03630.
    • Formula

    • C275H442N76O71S6
    • Absent Amino Acids

    • M
    • Common Amino Acids

    • CLIK
    • Mass

    • 6141.36
    • PI

    • 9.24
    • Basic Residues

    • 9
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 16
    • Net Charge

    • +7
    • Boman Index

    • -60.95
    • Hydrophobicity

    • -0.117
    • Aliphatic Index

    • 93.77
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 10345
    • Absorbance 280nm

    • 198.94
    • Polar Residues

    • 19

DRAMP03630

DRAMP03630 chydropathy plot
    • Function

    • Has antibacterial activity (Potential).
    • PTM

    • Contains three disulfide bonds (By similarity).
  • ·Literature 1
    • Title

    • Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
    • Reference

    • Physiol Genomics. 2005 Sep 21;23(1):5-17.
    • Author

    • Patil AA, Cai Y, Sang Y, Blecha F, Zhang G.