General Information

    • DRAMP ID

    • DRAMP03633

    • Peptide Name

    • Protein S100-A8 (Calgranulin-A; MRP-8; Human, mammals, animals)

    • Source

    • Homo sapiens (Human)

    • Family

    • Belongs to the S-100 family

    • Gene

    • S100A8

    • Sequence

    • MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

    • Sequence Length

    • 93

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Metal-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • The dimeric form of MRP8 is stabilized by hydrophobic interactions between mutually wrapped helices. There are two EF-hand motifs per monomer and each EF-hand bound one Ca(2+) with a different affinity [the affinity of the C-terminal EF-hand (EF-2) for Ca(2+) is stronger than that of the N-terminal EF-hand (EF-1)].

    • Helical Wheel Diagram

    • DRAMP03633 helical wheel diagram

    • PDB ID

    • 1MR8 resolved by X-ray.
  • 1MR8-> 

    • Predicted Structure

    • There is no predicted structure for DRAMP03633.

Physicochemical Information

    • Formula

    • C492H774N128O141S3

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • K

    • Mass

    • 10834.51

    • PI

    • 6.5

    • Basic Residues

    • 19

    • Acidic Residues

    • 15

    • Hydrophobic Residues

    • 34

    • Net Charge

    • +4

    • Boman Index

    • -150.13

    • Hydrophobicity

    • -0.397

    • Aliphatic Index

    • 96.45

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 11460

    • Absorbance 280nm

    • 124.57

    • Polar Residues

    • 20

DRAMP03633

DRAMP03633 chydropathy plot

Comments Information

    • Function

    • Has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn2+ which is essential for microbial growth. Can induce cell death via autophagy and apoptosis and this occurs through the cross-talk of mitochondria and lysosomes via reactive oxygen species (ROS) and the process involves BNIP3. Can regulate neutrophil number and apoptosis by an anti-apoptotic effect.

    • Tissue specificity

    • Calprotectin (S100A8/9) is predominantly expressed in myeloid cells.

    • Miscellaneous

    • Binds two calcium ions per molecule with an affinity similar to that of the S100 proteins (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Two calcium-binding proteins in infiltrate macrophages of rheumatoid arthritis.

    • Reference

    • Nature. 1987 Nov 5-11;330(6143):80-82.

    • Author

    • Odink K, Cerletti N, Brüggen J, Clerc RG, Tarcsay L, Zwadlo G, Gerhards G, Schlegel R, Sorg C.
  • ·Literature 2

    • Title

    • The structure of human MRP8, a member of the S100 calcium-binding protein family, by MAD phasing at 1.9 A resolution.

    • Reference

    • Acta Crystallogr D Biol Crystallogr. 2000 May;56(Pt 5):559-566.

    • Author

    • Ishikawa K, Nakagawa A, Tanaka I, Suzuki M, Nishihira J.