General Information

    • DRAMP ID

    • DRAMP03636

    • Peptide Name

    • Kaliocin-1 (one chain of Lactotransferrin; Human, mammals, animals)

    • Source

    • Homo sapiens (Human)

    • Family

    • Belongs to the transferrin family

    • Gene

    • LTF

    • Sequence

    • FFSASCVPGADKGQFPNLCRLCAGTGENKCA

    • Sequence Length

    • 31

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-

    • Target Organism

      • Gram-negative bacterium: Escherichia coli serotype O111.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03636 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03636.

Physicochemical Information

    • Formula

    • C136H211N39O42S4

    • Absent Amino Acids

    • HIMWY

    • Common Amino Acids

    • ACG

    • Mass

    • 3192.65

    • PI

    • 7.88

    • Basic Residues

    • 3

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +1

    • Boman Index

    • -30.8

    • Hydrophobicity

    • 0.016

    • Aliphatic Index

    • 47.42

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 250

    • Absorbance 280nm

    • 8.33

    • Polar Residues

    • 13

DRAMP03636

DRAMP03636 chydropathy plot

Comments Information

    • Function

    • Kaliocin-1 has antimicrobial activity and is able to permeabilize different ions through liposomal membranes without causing extensive damage to the outer and inner bacterial membranes.

    • Tissue specificity

    • High levels are found in saliva and tears, intermediate levels in serum and plasma, and low levels in urine.

Literature Information

  • ·Literature 1

    • Title

    • Potassium efflux induced by a new lactoferrin-derived peptide mimicking the effect of native human lactoferrin on the bacterial cytoplasmic membrane.

    • Reference

    • Biochemistry (Mosc). 2003 Feb;68(2):217-227.

    • Author

    • Viejo-Díaz M, Andrés MT, Pérez-Gil J, Sánchez M, Fierro JF.