General Information

    • DRAMP ID

    • DRAMP03638

    • Peptide Name

    • VpBD (V.philippinarum beta defensin; big defensin)

    • Source

    • Venerupis philippinarum (The manila clam)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • LCLDQKPEMEPFRKDAQQALEPSRQRRWLHRRCLSGRGFCRAICSIFEEPVRGNIDCYFGYNCCRRMFSHYRTS

    • Sequence Length

    • 74

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-positive bacteria: Staphyloccocus aureus (MIC=1.64-3.28 µM), Micrococcus luteus (MIC>26.26 µM), Bacillus sp. (MIC=13.13-26.26 µM);
      • Gram-negative bacteria: Vibrio anguillarum (MIC=13.13-26.26 µM), Entherobacter cloacae (MIC>26.26 µM), Vibrio ichthyoenteri (MIC=3.28-6.56 µM), Pseudomonas putida (MIC=1.64-3.28 µM), Proteus mirabilis (MIC>26.26 µM), Enterobacter sp. (MIC=13.13-26.26 µM)

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys33 and Cys63,Cys40 and Cys57,Cys44 and Cys64.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03638 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03638.

Physicochemical Information

    • Formula

    • C384H597N123O106S9

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • R

    • Mass

    • 8921.27

    • PI

    • 9.2

    • Basic Residues

    • 16

    • Acidic Residues

    • 8

    • Hydrophobic Residues

    • 18

    • Net Charge

    • +8

    • Boman Index

    • -231.62

    • Hydrophobicity

    • -0.774

    • Aliphatic Index

    • 50.14

    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 10345

    • Absorbance 280nm

    • 141.71

    • Polar Residues

    • 22

DRAMP03638

DRAMP03638 chydropathy plot

Comments Information

    • Function

    • The rVpBD displays broad-spectrum inhibitory activity towards all tested bacteria with the highest activity against Staphyloccocus aureus and Pseudomonas putida.

Literature Information

  • ·Literature 1

    • Title

    • Molecular characterization of a novel big defensin from clam Venerupis philippinarum.

    • Reference

    • PLoS One. 2010 Oct 20;5(10):e13480.

    • Author

    • Zhao J, Li C, Chen A, Li L, Su X, Li T.