General Information

    • DRAMP ID

    • DRAMP03641

    • Peptide Name

    • Longicornsin (defensin-like; Arthropods, invertebrates, animals)

    • Source

    • Haemaphysalis longicornis

    • Family

    • Not found

    • Gene

    • sGDLP

    • Sequence

    • DFGCGQGMIFMCQRRCMRLYPGSTGFCRGFRCMCDTHIPLRPPFMVG

    • Sequence Length

    • 47

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • Gram-positive bacterium: Staphylococcus aureus;
      • Gram-negative bacteria: Escherichia coli, Pseudomonas aeruginosa, Helicobacter pylori.
      • Yeast: Candida albicans.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03641 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03641.

Physicochemical Information

    • Formula

    • C231H357N69O58S11

    • Absent Amino Acids

    • AEKNW

    • Common Amino Acids

    • G

    • Mass

    • 5381.46

    • PI

    • 8.98

    • Basic Residues

    • 7

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +5

    • Boman Index

    • -66.75

    • Hydrophobicity

    • 0.051

    • Aliphatic Index

    • 39.36

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 40.54

    • Polar Residues

    • 17

DRAMP03641

DRAMP03641 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity.

Literature Information

  • ·Literature 1

    • Title

    • A novel defensin-like peptide from salivary glands of the hard tick, Haemaphysalis longicorn.

    • Reference

    • Protein Sci. 2010 Mar;19(3):392-327.

    • Author

    • Lu X, Che Q, Lv Y, Wang M, Lu Z, Feng F, Liu J, Yu H.