General Information

    • DRAMP ID

    • DRAMP03643

    • Peptide Name

    • Liver-expressed antimicrobial peptide 2 (LEAP-2; Birds, animals)

    • Source

    • Gallus gallus (Chicken)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • RLKRMTPFWRGVSLRPVGASCRDNSECITMLCRKNRCFLRTASE

    • Sequence Length

    • 44

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03643 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03643.

Physicochemical Information

    • Formula

    • C217H363N73O60S6

    • Absent Amino Acids

    • HQY

    • Common Amino Acids

    • R

    • Mass

    • 5147.08

    • PI

    • 10.72

    • Basic Residues

    • 10

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +7

    • Boman Index

    • -131.1

    • Hydrophobicity

    • -0.464

    • Aliphatic Index

    • 62.05

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 5750

    • Absorbance 280nm

    • 133.72

    • Polar Residues

    • 15

DRAMP03643

DRAMP03643 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Bioinformatic discovery and initial characterisation of nine novel antimicrobial peptide genes in the chicken.

    • Reference

    • Immunogenetics. 2004 Jun;56(3):170-177.

    • Author

    • Lynn DJ, Higgs R, Gaines S, Tierney J, James T, Lloyd AT, Fares MA, Mulcahy G, O'Farrelly C.