General Information

    • DRAMP ID

    • DRAMP03647

    • Peptide Name

    • Cathelicidin-B1 (CATH-B1; cathelicidin; Birds, animals)

    • Source

    • Gallus gallus (Chicken)

    • Family

    • Not found

    • Gene

    • CATHB1

    • Sequence

    • PIRNWWIRIWEWLNGIRKRLRQRSPFYVRGHLNVTSTPQP

    • Sequence Length

    • 40

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-negative bacteria: Escherichia coli (MIC=2.5 µM), Pseudomonas aeruginosa (MIC=0.63 µM);
      • Gram-positive bacterium: Staphylococcus aureus (MIC=1.25 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Free

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03647 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03647.

Physicochemical Information

    • Formula

    • C233H357N73O53

    • Absent Amino Acids

    • ACDM

    • Common Amino Acids

    • R

    • Mass

    • 5028.85

    • PI

    • 12.13

    • Basic Residues

    • 9

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +8

    • Boman Index

    • -107.84

    • Hydrophobicity

    • -0.853

    • Aliphatic Index

    • 82.75

    • Half Life

      • Mammalian:>20 hour
      • Yeast:>20 hour
      • E.coli:?

    • Extinction Coefficient Cystines

    • 23490

    • Absorbance 280nm

    • 602.31

    • Polar Residues

    • 10

DRAMP03647

DRAMP03647 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Chicken cathelicidin-B1, an antimicrobial guardian at the mucosal M cell gateway.

    • Reference

    • Proc Natl Acad Sci U S A. 2007 Sep 18;104(38):15063-15068.

    • Author

    • Goitsuka R, Chen CL, Benyon L, Asano Y, Kitamura D, Cooper MD.
  • ·Literature 2

    • Title

    • Full-length cDNAs from chicken bursal lymphocytes to facilitate gene function analysis.

    • Reference

    • Genome Biol. 2005;6(1):R6.

    • Author

    • Caldwell RB, Kierzek AM, Arakawa H, Bezzubov Y, Zaim J, Fiedler P, Kutter S, Blagodatski A, Kostovska D, Koter M, Plachy J, Carninci P, Hayashizaki Y, Buerstedde JM.