General Information

    • DRAMP ID

    • DRAMP03649

    • Peptide Name

    • Gallinacin-1 alpha (Gal-1 alpha; Antimicrobial peptide CHP2; Birds, animals)

    • Source

    • Gallus gallus (Chicken)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Not found

    • Sequence

    • GRKSDCFRKNGFCAFLKCPYLTLISGKCSRFHLCCKRIW

    • Sequence Length

    • 39

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • Gram-negative bacterium: Escherichia coli ML-35;
      • Gram-positive bacteria: Staphylococcus aureus, Listeria monocytogenes.
      • Yeast: Candida albicans.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03649 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03649.

Physicochemical Information

    • Formula

    • C205H322N60O48S6

    • Absent Amino Acids

    • EMQV

    • Common Amino Acids

    • C

    • Mass

    • 4587.54

    • PI

    • 9.7

    • Basic Residues

    • 10

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +9

    • Boman Index

    • -64.28

    • Hydrophobicity

    • -0.092

    • Aliphatic Index

    • 62.56

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 193.82

    • Polar Residues

    • 15

DRAMP03649

DRAMP03649 chydropathy plot

Comments Information

    • PTM

    • Contains three disulfide bonds 6-34; 13-28; 18-35.

Literature Information

  • ·Literature 1

    • Title

    • Isolation of antimicrobial peptides from avian heterophils.

    • Reference

    • J Leukoc Biol. 1994 Nov;56(5):661-665.

    • Author

    • Evans EW, Beach GG, Wunderlich J, Harmon BG.
  • ·Literature 2

    • Title

    • Gallinacins: cysteine-rich antimicrobial peptides of chicken leukocytes.

    • Reference

    • FEBS Lett. 1994 Apr 11;342(3):281-285.

    • Author

    • Harwig SS, Swiderek KM, Kokryakov VN, Tan L, Lee TD, Panyutich EA, Aleshina GM, Shamova OV, Lehrer RI.