General Information

    • DRAMP ID

    • DRAMP03651

    • Peptide Name

    • Gallinacin-3 (Gal-3; Beta-defensin 3; Birds, animals)

    • Source

    • Gallus gallus (Chicken)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • GAL3

    • Sequence

    • IATQCRIRGGFCRVGSCRFPHIAIGKCATFISCCGRAY

    • Sequence Length

    • 38

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03651 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03651.

Physicochemical Information

    • Formula

    • C177H285N57O45S6

    • Absent Amino Acids

    • DELMNW

    • Common Amino Acids

    • C

    • Mass

    • 4123.92

    • PI

    • 9.49

    • Basic Residues

    • 7

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +7

    • Boman Index

    • -45.23

    • Hydrophobicity

    • 0.429

    • Aliphatic Index

    • 69.47

    • Half Life

      • Mammalian:20 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 50.41

    • Polar Residues

    • 16

DRAMP03651

DRAMP03651 chydropathy plot

Comments Information

    • Tissue specificity

    • Strongly expressed in the tongue, bone marrow, bursa of Fabricius and trachea. Also expressed in skin, esophagus and air sacs. Weak expression in the large intestine, kidney and ovary. Expressed in the vagina and ovarian stroma, but not in the ovarian follicle.

    • Developmental stage

    • In the vagina expression is higher in laying hens than in non-laying hens, and is higher in older laying hens than in young laying hens. Induction

    • PTM

    • contains three disulfide bonds 3-31; 10-25; 15-33.

Literature Information

  • ·Literature 1

    • Title

    • Gallinacin-3, an inducible epithelial beta-defensin in the chicken.

    • Reference

    • Infect Immun. 2001 Apr;69(4):2684-2691.

    • Author

    • Zhao C, Nguyen T, Liu L, Sacco RE, Brogden KA, Lehrer RI.
  • ·Literature 2

    • Title

    • Bioinformatic discovery and initial characterisation of nine novel antimicrobial peptide genes in the chicken.

    • Reference

    • Immunogenetics. 2004 Jun;56(3):170-177.

    • Author

    • Lynn DJ, Higgs R, Gaines S, Tierney J, James T, Lloyd AT, Fares MA, Mulcahy G, O'Farrelly C.
  • ·Literature 3

    • Title

    • Effects of age, egg-laying activity, and Salmonella-inoculation on the expressions of gallinacin mRNA in the vagina of the hen oviduct.

    • Reference

    • J Reprod Dev. 2006 Apr;52(2):211-218.

    • Author

    • Yoshimura Y, Ohashi H, Subedi K, Nishibori M, Isobe N.