General Information

    • DRAMP ID

    • DRAMP03652

    • Peptide Name

    • Gallinacin-4 (Gal-4; Beta-defensin 4; Birds, animals)

    • Source

    • Gallus gallus (Chicken)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • GAL4

    • Sequence

    • RYHMQCGYRGTFCTPGKCPHGNAYLGLCRPKYSCCRWL

    • Sequence Length

    • 38

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-

    • Target Organism

      • Gram-negative bacteria: Salmonella typhimurium, Salmonella entiriditis.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03652 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03652.

Physicochemical Information

    • Formula

    • C193H289N59O48S7

    • Absent Amino Acids

    • DEIV

    • Common Amino Acids

    • C

    • Mass

    • 4428.2

    • PI

    • 9.3

    • Basic Residues

    • 8

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 6

    • Net Charge

    • +8

    • Boman Index

    • -64.77

    • Hydrophobicity

    • -0.563

    • Aliphatic Index

    • 33.42

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 11835

    • Absorbance 280nm

    • 319.86

    • Polar Residues

    • 19

DRAMP03652

DRAMP03652 chydropathy plot

Comments Information

    • Tissue specificity

    • Strong expression in the bone marrow and testis. Widely expressed. Weak expression in the ovarian stroma, but not expressed in the ovarian follicles. PTM

Literature Information

  • ·Literature 1

    • Title

    • The chicken host peptides, gallinacins 4, 7, and 9 have antimicrobial activity against Salmonella serovars.

    • Reference

    • Biochem Biophys Res Commun. 2007 Apr 27;356(1):169-174.

    • Author

    • Milona P, Townes CL, Bevan RM, Hall J.
  • ·Literature 2

    • Title

    • A genome-wide screen identifies a single beta-defensin gene cluster in the chicken: implications for the origin and evolution of mammalian defensins.

    • Reference

    • BMC Genomics. 2004 Aug 13;5(1):56.

    • Author

    • Xiao Y, Hughes AL, Ando J, Matsuda Y, Cheng JF, Skinner-Noble D, Zhang G.
  • ·Literature 3

    • Title

    • Bioinformatic discovery and initial characterisation of nine novel antimicrobial peptide genes in the chicken.

    • Reference

    • Immunogenetics. 2004 Jun;56(3):170-177.

    • Author

    • Lynn DJ, Higgs R, Gaines S, Tierney J, James T, Lloyd AT, Fares MA, Mulcahy G, O'Farrelly C.
  • ·Literature 4

    • Title

    • Changes in the expression of gallinacins, antimicrobial peptides, in ovarian follicles during follicular growth and in response

    • Reference

    • Reproduction. 2007 Jan;133(1):127-133.

    • Author

    • Subedi K, Isobe N, Nishibori M, Yoshimura Y.