General Information

    • DRAMP ID

    • DRAMP03653

    • Peptide Name

    • Gallinacin-5 (Gal-5; Beta-defensin 5; Birds, animals)

    • Source

    • Gallus gallus (Chicken)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • GAL5

    • Sequence

    • GLPQDCERRGGFCSHKSCPPGIGRIGLCSKEDFCCRSRWYS

    • Sequence Length

    • 41

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-

    • Target Organism

      • Gram-negative bacteria: Salmonella typhimurium, Salmonella entiriditis.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03653 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03653.

Physicochemical Information

    • Formula

    • C193H300N62O57S6

    • Absent Amino Acids

    • AMNTV

    • Common Amino Acids

    • CG

    • Mass

    • 4593.25

    • PI

    • 8.67

    • Basic Residues

    • 8

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +4

    • Boman Index

    • -102.81

    • Hydrophobicity

    • -0.663

    • Aliphatic Index

    • 38.05

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 184.13

    • Polar Residues

    • 18

DRAMP03653

DRAMP03653 chydropathy plot

Comments Information

    • Tissue specificity

    • Strong expression in the tongue and bone marrow. Low expression in the esophagus, trachea, lung, brain and ovary. Expressed in the ovarian stroma, but not in the ovarian follicles. PTM

Literature Information

  • ·Literature 1

    • Title

    • The chicken host peptides, gallinacins 4, 7, and 9 have antimicrobial activity against Salmonella serovars.

    • Reference

    • Biochem Biophys Res Commun. 2007 Apr 27;356(1):169-174.

    • Author

    • Milona P, Townes CL, Bevan RM, Hall J.
  • ·Literature 2

    • Title

    • A genome-wide screen identifies a single beta-defensin gene cluster in the chicken: implications for the origin and evolution of mammalian defensins.

    • Reference

    • BMC Genomics. 2004 Aug 13;5(1):56.

    • Author

    • Xiao Y, Hughes AL, Ando J, Matsuda Y, Cheng JF, Skinner-Noble D, Zhang G.
  • ·Literature 3

    • Title

    • Bioinformatic discovery and initial characterisation of nine novel antimicrobial peptide genes in the chicken.

    • Reference

    • Immunogenetics. 2004 Jun;56(3):170-177.

    • Author

    • Lynn DJ, Higgs R, Gaines S, Tierney J, James T, Lloyd AT, Fares MA, Mulcahy G, O'Farrelly C.
  • ·Literature 4

    • Title

    • Changes in the expression of gallinacins, antimicrobial peptides, in ovarian follicles during follicular growth and in response

    • Reference

    • Reproduction. 2007 Jan;133(1):127-133.

    • Author

    • Subedi K, Isobe N, Nishibori M, Yoshimura Y.