General Information

    • DRAMP ID

    • DRAMP03658

    • Peptide Name

    • Gallinacin-10 (Gal-10; Beta-defensin 10; Birds, animals)

    • Source

    • Gallus gallus (Chicken)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • GAL10

    • Sequence

    • FPDTVACRTQGNFCRAGACPPTFTISGQCHGGLLNCCAKIPAQ

    • Sequence Length

    • 43

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03658 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03658.

Physicochemical Information

    • Formula

    • C189H297N57O56S6

    • Absent Amino Acids

    • EMWY

    • Common Amino Acids

    • C

    • Mass

    • 4456.15

    • PI

    • 8.35

    • Basic Residues

    • 4

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +3

    • Boman Index

    • -38.26

    • Hydrophobicity

    • 0.095

    • Aliphatic Index

    • 54.65

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 375

    • Absorbance 280nm

    • 8.93

    • Polar Residues

    • 18

DRAMP03658

DRAMP03658 chydropathy plot

Comments Information

    • Tissue specificity

    • Strong expression in the testis, liver, gall bladder and kidney. Also expressed in the ovary and male and female reproductive tracts. Expressed in the ovarian stroma and the theca and granulosa layers of the ovarian follicle. Developmental stage

Literature Information

  • ·Literature 1

    • Title

    • Bioinformatic discovery and initial characterisation of nine novel antimicrobial peptide genes in the chicken.

    • Reference

    • Immunogenetics. 2004 Jun;56(3):170-177.

    • Author

    • nn DJ, Higgs R, Gaines S, Tierney J, James T, Lloyd AT, Fares MA, Mulcahy G, O'Farrelly C.
  • ·Literature 2

    • Title

    • A genome-wide screen identifies a single beta-defensin gene cluster in the chicken: implications for the origin and evolution of mammalian defensins.

    • Reference

    • BMC Genomics. 2004 Aug 13;5(1):56.

    • Author

    • Xiao Y, Hughes AL, Ando J, Matsuda Y, Cheng JF, Skinner-Noble D, Zhang G.
  • ·Literature 3

    • Title

    • Changes in the expression of gallinacins, antimicrobial peptides, in ovarian follicles during follicular growth and in response to lipopolysaccharide in laying hens (Gallus domesticus).

    • Reference

    • Reproduction. 2007 Jan;133(1):127-133.

    • Author

    • Subedi K, Isobe N, Nishibori M, Yoshimura Y.